Rabbit anti-Human MCM3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12081P

• Product Name:
• Rabbit anti-Human MCM3 Polyclonal Antibody

• Synonym:
• HCC5; P1.h; RLFB; P1-MCM3; MCM3

• Description:
• The antibody against MCM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human MCM3 (NP_002379.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human MCM3 (NP_002379.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MCM3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDI

• Gene ID:
• 4172

• Uniprot-ID:
• P25205

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, PC-12, NIH/3T3, COS-1, COS-7