Rabbit anti-Human MAPK8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08401P

• Product Name:
• Rabbit anti-Human MAPK8 Polyclonal Antibody

• Synonym:
• JNK; JNK1; PRKM8; SAPK1; JNK-46; JNK1A2; SAPK1c; JNK21B1/2

• Description:
• The antibody against MAPK8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPK8(NP_620637.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPK8(NP_620637.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MAPK8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEE

• Gene ID:
• 5599

• Uniprot-ID:
• P45983

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Rat brain