Rabbit anti-Human MAPK11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02367P

• Product Name:
• Rabbit anti-Human MAPK11 Polyclonal Antibody

• Synonym:
• P38B; SAPK2; p38-2; PRKM11; SAPK2B; p38Beta; P38BETA2; MAPK11

• Description:
• The antibody against MAPK11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 264-364 of human MAPK11 (NP_002742.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 264-364 of human MAPK11 (NP_002742.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MAPK11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ

• Gene ID:
• 5600

• Uniprot-ID:
• Q15759

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y, MCF7