Rabbit anti-Human Map2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04145P

• Product Name:
• Rabbit anti-Human Map2 Polyclonal Antibody

• Synonym:
• MAP-2; Mtap2; Mtap-2; repro4; G1-397-34; Map2

• Description:
• The antibody against Map2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Map2 (P11137) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Map2 (P11137).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Map2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTA

• Gene ID:
• 17756

• Purification Method:
• Affinity purification

• Positive Samples:
• OVCAR3, 293T, HepG2, SH-SY5Y, Mouse brain, Mouse thymus