Rabbit anti-Human MAP1LC3B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07874P

• Product Name:
• Rabbit anti-Human MAP1LC3B Polyclonal Antibody

• Synonym:
• LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3; 3B

• Description:
• The antibody against MAP1LC3B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human MAP1LC3B (NP_073729.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-50 of human MAP1LC3B (NP_073729.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MAP1LC3B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKT

• Gene ID:
• 81631

• Uniprot-ID:
• Q9GZQ8

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T Chloroquine, 293T, C6 Chloroquine, C6