Rabbit anti-Human macroH2A.1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07902P

• Product Name:
• Rabbit anti-Human macroH2A.1 Polyclonal Antibody

• Synonym:
• H2A.y; H2A/y; H2AFY; mH2A1; H2AF12M; MACROH2A1.1; macroH2A1.2; macroH2A.1

• Description:
• The antibody against macroH2A.1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human macroH2A.1 (NP_613258.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human macroH2A.1 (NP_613258.2).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• macroH2A.1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL

• Gene ID:
• 9555

• Uniprot-ID:
• O75367

• Purification Method:
• Affinity purification

• Positive Samples:
• A549, HeLa, HeLa acid extrcat, Rat brain