Rabbit anti-Human LYZL1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06011P

• Product Name:
• Rabbit anti-Human LYZL1 Polyclonal Antibody

• Synonym:
• LYC2; LYZD1; KAAG648; PRO1278; bA534G20.1; LYZL1

• Description:
• The antibody against LYZL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human LYZL1 (NP_115906.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human LYZL1 (NP_115906.3).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• LYZL1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS

• Gene ID:
• 84569

• Uniprot-ID:
• Q6UWQ5

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat testis