Rabbit anti-Human LTC4S Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05287P

• Product Name:
• Rabbit anti-Human LTC4S Polyclonal Antibody

• Synonym:
• LTC4S

• Description:
• The antibody against LTC4S was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human LTC4S (NP_665874.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human LTC4S (NP_665874.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• LTC4S

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

• Gene ID:
• 4056

• Uniprot-ID:
• Q16873

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549