Rabbit anti-Human LPAR4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07389P

• Product Name:
• Rabbit anti-Human LPAR4 Polyclonal Antibody

• Synonym:
• LPA4; P2Y9; GPR23; P2RY9; P2Y5-LIKE; LPAR4

• Description:
• The antibody against LPAR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 311-370 of human LPAR4 (Q99677) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 311-370 of human LPAR4 (Q99677).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• LPAR4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

• Gene ID:
• 2846

• Uniprot-ID:
• Q99677

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, SH-SY5Y, Mouse ovary, Mouse brain, Rat brain