Rabbit anti-Human LHCGR Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08443P

• Product Name:
• Rabbit anti-Human LHCGR Polyclonal Antibody

• Synonym:
• LHCGR; HHG; LCGR; LGR2; LH/CG-R; LH/CGR; LHR; LHRHR; LSH-R; ULG5; lutropin-choriogonadotropic hormone receptor

• Description:
• The antibody against LHCGR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human LHCGR（NP_000224.2） as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LHCGR（NP_000224.2）.

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• LHCGR

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF

• Gene ID:
• 3973

• Uniprot-ID:
• P22888

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse ovary