Rabbit anti-Human LBP Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06903P

• Product Name:
• Rabbit anti-Human LBP Polyclonal Antibody

• Synonym:
• BPIFD2; LBP

• Description:
• The antibody against LBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human LBP (NP_004130.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LBP (NP_004130.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• LBP

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLN

• Gene ID:
• 3929

• Uniprot-ID:
• P18428

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, Human serum, Mouse ovary, Mouse uterus, Rat lung, Rat liver, Rat kidney