Rabbit anti-Human Lamin B1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11708P

• Product Name:
• Rabbit anti-Human Lamin B1 Polyclonal Antibody

• Synonym:
• LMN; ADLD; LMN2; LMNB; MCPH26; Lamin B1

• Description:
• The antibody against Lamin B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Lamin B1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTS

• Gene ID:
• 4001

• Uniprot-ID:
• P20700

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, MCF7, mouse brain, mouse spleen