• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human Lamin B1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-11708P
  • Product Name:
  • Rabbit anti-Human Lamin B1 Polyclonal Antibody
  • Synonym:
  • LMN; ADLD; LMN2; LMNB; MCPH26; Lamin B1
  • Description:
  • The antibody against Lamin B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 361-460 of human Lamin B1 (NP_005564.1).
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, IF/ICC, IP, ELISA
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • Lamin B1
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTS
  • Gene ID:
  • 4001
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • Jurkat, MCF7, mouse brain, mouse spleen
  • Pre product:Rabbit anti-Human GABRB3 Polyclonal Antibody-ADA-11707P
  • Online Inquiry

    refresh