Rabbit anti-Human KRT80 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00437P

• Product Name:
• Rabbit anti-Human KRT80 Polyclonal Antibody

• Synonym:
• KB20; KRT80

• Description:
• The antibody against KRT80 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 242-452 of human KRT80 (NP_872313.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 242-452 of human KRT80 (NP_872313.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KRT80

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE

• Gene ID:
• 144501

• Uniprot-ID:
• Q6KB66

• Purification Method:
• Affinity purification