Rabbit anti-Human KRAS Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12304P

• Product Name:
• Rabbit anti-Human KRAS Polyclonal Antibody

• Synonym:
• NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; 'C-K-RAS; c-Ki-ras; c-Ki-ras2; KRAS

• Description:
• The antibody against KRAS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 30-189 of human KRAS (NP_203524.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 30-189 of human KRAS (NP_203524.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KRAS

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM

• Gene ID:
• 3845

• Uniprot-ID:
• P01116

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HT-29, A-549, NIH/3T3, C6