Rabbit anti-Human KMT5C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13532P

• Product Name:
• Rabbit anti-Human KMT5C Polyclonal Antibody

• Synonym:
• SUV420H2; Suv4-20h2; 5C

• Description:
• The antibody against KMT5C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KMT5C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC

• Gene ID:
• 84787

• Uniprot-ID:
• Q86Y97

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, Jurkat, Mouse thymus