Rabbit anti-Human KLK6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02147P

• Product Name:
• Rabbit anti-Human KLK6 Polyclonal Antibody

• Synonym:
• hK6; Bssp; Klk7; SP59; PRSS9; PRSS18; KLK6

• Description:
• The antibody against KLK6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KLK6 (NP_002765.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KLK6 (NP_002765.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KLK6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK

• Gene ID:
• 5653

• Uniprot-ID:
• Q92876

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29