Rabbit anti-Human KLF9 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12703P

• Product Name:
• Rabbit anti-Human KLF9 Polyclonal Antibody

• Synonym:
• BTEB; BTEB1; KLF9

• Description:
• The antibody against KLF9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human KLF9 (NP_001197.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human KLF9 (NP_001197.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KLF9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC

• Gene ID:
• 687

• Uniprot-ID:
• Q13886

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, A-549, K-562, Mouse kidney, Rat kidney