Rabbit anti-Human KIR2DL4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03272P

• Product Name:
• Rabbit anti-Human KIR2DL4 Polyclonal Antibody

• Synonym:
• G9P; CD158D; KIR103; KIR-2DL4; KIR103AS; KIR-103AS; KIR2DL4

• Description:
• The antibody against KIR2DL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-242 of human KIR2DL4 (NP_002246.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-242 of human KIR2DL4 (NP_002246.5).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KIR2DL4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH

• Gene ID:
• 3805

• Uniprot-ID:
• Q99706

• Purification Method:
• Affinity purification

• Positive Samples:
• 293F transfected with KIR2DL4