Rabbit anti-Human KIR2DL3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04537P

• Product Name:
• Rabbit anti-Human KIR2DL3 Polyclonal Antibody

• Synonym:
• p58; NKAT; GL183; NKAT2; CD158b; KIR2DL; NKAT2A; NKAT2B; CD158B2; KIR-K7b; KIR-K7c; KIR2DS5; KIRCL23; KIR-023GB; KIR2DL3

• Description:
• The antibody against KIR2DL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3 (NP_056952.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3 (NP_056952.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KIR2DL3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

• Gene ID:
• 3804

• Uniprot-ID:
• P43628

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, Mouse liver, Mouse kidney, Mouse heart