Rabbit anti-Human KCNN3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05888P

• Product Name:
• Rabbit anti-Human KCNN3 Polyclonal Antibody

• Synonym:
• SK3; ZLS3; hSK3; SKCA3; KCa2.3; KCNN3

• Description:
• The antibody against KCNN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 631-731 of human KCNN3 (NP_002240.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 631-731 of human KCNN3 (NP_002240.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KCNN3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC

• Gene ID:
• 3782

• Uniprot-ID:
• Q9UGI6

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, Raji, 293T, Mouse heart, Mouse liver, Mouse skeletal muscle, Rat skeletal muscle, Rat brain