Rabbit anti-Human KCNJ12 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05682P

• Product Name:
• Rabbit anti-Human KCNJ12 Polyclonal Antibody

• Synonym:
• IRK2; hIRK; IRK-2; hIRK1; KCNJN1; Kir2.2; kcnj12x; hkir2.2x; KCNJ12

• Description:
• The antibody against KCNJ12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KCNJ12

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI

• Gene ID:
• 3768

• Uniprot-ID:
• Q14500

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Rat brain