Rabbit anti-Human KCNA1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04064P

• Product Name:
• Rabbit anti-Human KCNA1 Polyclonal Antibody

• Synonym:
• EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1; KCNA1

• Description:
• The antibody against KCNA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 426-495 of human KCNA1 (NP_000208.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 426-495 of human KCNA1 (NP_000208.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KCNA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV

• Gene ID:
• 3736

• Uniprot-ID:
• Q09470

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Mouse brain, Mouse spinal cord, Rat brain