Rabbit anti-Human KAT1/HAT1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11124P

• Product Name:
• Rabbit anti-Human KAT1/HAT1 Polyclonal Antibody

• Synonym:
• KAT1; KAT1/HAT1

• Description:
• The antibody against KAT1/HAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 245-419 of human KAT1/KAT1/HAT1 (NP_003633.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 245-419 of human KAT1/KAT1/HAT1 (NP_003633.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KAT1/HAT1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE

• Gene ID:
• 8520

• Uniprot-ID:
• O14929

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, SW480, Jurkat, 293T, HeLa, HepG2, U-251MG, Mouse spleen, Rat testis