Rabbit anti-Human Kaiso/ZBTB33 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03322P

• Product Name:
• Rabbit anti-Human Kaiso/ZBTB33 Polyclonal Antibody

• Synonym:
• ZNF348; ZNF-kaiso; Kaiso/ZBTB33

• Description:
• The antibody against Kaiso/ZBTB33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Kaiso/ZBTB33

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY

• Gene ID:
• 10009

• Uniprot-ID:
• Q86T24

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, Mouse kidney, Mouse skeletal muscle