Rabbit anti-Human ITLN1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09357P

• Product Name:
• Rabbit anti-Human ITLN1 Polyclonal Antibody

• Synonym:
• HL1; LFR; HL-1; INTL; ITLN; hIntL; omentin; ITLN1

• Description:
• The antibody against ITLN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-313 of human ITLN1 (NP_060095.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-313 of human ITLN1 (NP_060095.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ITLN1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR

• Gene ID:
• 55600

• Uniprot-ID:
• Q8WWA0

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse heart, Rat intestine