Rabbit anti-Human IRF5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00318P

• Product Name:
• Rabbit anti-Human IRF5 Polyclonal Antibody

• Synonym:
• SLEB10; IRF5

• Description:
• The antibody against IRF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IRF5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPL

• Gene ID:
• 3663

• Uniprot-ID:
• Q13568

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T