Rabbit anti-Human IPO7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07288P

• Product Name:
• Rabbit anti-Human IPO7 Polyclonal Antibody

• Synonym:
• Imp7; RANBP7; IPO7

• Description:
• The antibody against IPO7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human IPO7 (NP_006382.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human IPO7 (NP_006382.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IPO7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN

• Gene ID:
• 10527

• Uniprot-ID:
• O95373

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, HepG2, HeLa, Mouse heart, Mouse brain, Rat brain