Rabbit anti-Human IPO11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05509P

• Product Name:
• Rabbit anti-Human IPO11 Polyclonal Antibody

• Synonym:
• RanBP11; IPO11

• Description:
• The antibody against IPO11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 776-975 of human IPO11 (NP_057422.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 776-975 of human IPO11 (NP_057422.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IPO11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KGIIEGERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETVDTEIVTQLQEFLQGF

• Gene ID:
• 51194

• Uniprot-ID:
• Q9UI26

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, A-549, Mouse heart, Mouse kidney, Mouse lung, Mouse spleen, Mouse testis