Rabbit anti-Human IP6K2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06251P

• Product Name:
• Rabbit anti-Human IP6K2 Polyclonal Antibody

• Synonym:
• PIUS; IHPK2; InsP6K2; IP6K2

• Description:
• The antibody against IP6K2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human IP6K2 (NP_057375.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human IP6K2 (NP_057375.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IP6K2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWS

• Gene ID:
• 51447

• Uniprot-ID:
• Q9UHH9

• Purification Method:
• Affinity purification