Rabbit anti-Human IL4I1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09057P

• Product Name:
• Rabbit anti-Human IL4I1 Polyclonal Antibody

• Synonym:
• LAO; FIG1; LAAO; hIL4I1; IL4I1

• Description:
• The antibody against IL4I1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-220 of human IL4I1 (NP_690863.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-220 of human IL4I1 (NP_690863.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL4I1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSSHRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPEDIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGN

• Gene ID:
• 259307

• Uniprot-ID:
• Q96RQ9

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1, Mouse spleen, Rat testis