Rabbit anti-Human IL3RA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08797P

• Product Name:
• Rabbit anti-Human IL3RA Polyclonal Antibody

• Synonym:
• IL3R; CD123; IL3RX; IL3RY; IL3RAY; hIL-3Ra; IL-3R-alpha; IL3RA

• Description:
• The antibody against IL3RA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL3RA (NP_002174.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL3RA (NP_002174.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL3RA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENS

• Gene ID:
• 3563

• Uniprot-ID:
• P26951

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549