Rabbit anti-Human IL31RA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03161P

• Product Name:
• Rabbit anti-Human IL31RA Polyclonal Antibody

• Synonym:
• CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17; IL31RA

• Description:
• The antibody against IL31RA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-321 of human IL31RA (NP_001284501.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-321 of human IL31RA (NP_001284501.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL31RA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGVPSEGPETKVEN

• Gene ID:
• 133396

• Uniprot-ID:
• Q8NI17

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG