• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti-Human IL2RB Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-03139P
  • Product Name:
  • Rabbit anti-Human IL2RB Polyclonal Antibody
  • Synonym:
  • CD122; IMD63; IL15RB; P70-75; IL2RB
  • Description:
  • The antibody against IL2RB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 316-431 of human IL2RB (NP_000869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 316-431 of human IL2RB (NP_000869.1).
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • IL2RB
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • GGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFS
  • Gene ID:
  • 3560
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • Jurkat, Raji, RAW264.7
  • Pre product:Rabbit anti-Human SET/TAF1 Polyclonal Antibody-ADA-03138P
  • Online Inquiry

    refresh