Rabbit anti-Human IL27RA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08673P

• Product Name:
• Rabbit anti-Human IL27RA Polyclonal Antibody

• Synonym:
• CRL1; TCCR; WSX1; IL27R; IL-27RA; zcytor1; IL27RA

• Description:
• The antibody against IL27RA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-283 of human IL27RA (NP_004834.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 33-283 of human IL27RA (NP_004834.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL27RA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGIT

• Gene ID:
• 9466

• Uniprot-ID:
• Q6UWB1

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, Mouse liver, Rat liver