Rabbit anti-Human IL22RA2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02659P

• Product Name:
• Rabbit anti-Human IL22RA2 Polyclonal Antibody

• Synonym:
• CRF2X; CRF2-10; CRF2-S1; IL-22BP; IL-22RA2; ZCYTOR16; IL-22R-alpha-2; IL22RA2

• Description:
• The antibody against IL22RA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-231 of human IL22RA2 (NP_851826.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-231 of human IL22RA2 (NP_851826.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL22RA2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

• Gene ID:
• 116379

• Uniprot-ID:
• Q969J5

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spleen, Mouse lung, Rat spleen, Rat brain, Rat liver