Rabbit anti-Human IL22RA1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01722P

• Product Name:
• Rabbit anti-Human IL22RA1 Polyclonal Antibody

• Synonym:
• IL22R; CRF2-9; IL22R1; IL22RA1

• Description:
• The antibody against IL22RA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-230 of human IL22RA1 (NP_067081.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 16-230 of human IL22RA1 (NP_067081.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL22RA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYS

• Gene ID:
• 58985

• Uniprot-ID:
• Q8N6P7

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HepG2, A-549, BxPC-3, Mouse liver, Rat liver