Rabbit anti-Human IL22 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11119P

• Product Name:
• Rabbit anti-Human IL22 Polyclonal Antibody

• Synonym:
• TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23; IL22

• Description:
• The antibody against IL22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL22

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

• Gene ID:
• 50616

• Uniprot-ID:
• Q9GZX6

• Purification Method:
• Affinity purification

• Positive Samples:
• HL-60