Rabbit anti-Human IL17A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13060P

• Product Name:
• Rabbit anti-Human IL17A Polyclonal Antibody

• Synonym:
• IL17; CTLA8; IL-17; ILA17; CTLA-8; IL-17A; IL17A

• Description:
• The antibody against IL17A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-155 of human IL17A (NP_002181.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-155 of human IL17A (NP_002181.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL17A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

• Gene ID:
• 3605

• Uniprot-ID:
• Q16552

• Purification Method:
• Affinity purification

• Positive Samples:
• Recombinant Human IL-17A Protein