Rabbit anti-Human IKKγ Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12483P

• Product Name:
• Rabbit anti-Human IKKγ Polyclonal Antibody

• Synonym:
• IP; IP1; IP2; FIP3; IKKG; IPD2; NEMO; FIP-3; Fip3p; IMD33; SAIDX; AMCBX1; EDAID1; IKKAP1; ZC2HC9; IKK-gamma; IKKγ

• Description:
• The antibody against IKKγ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-390 of human IKKγ (NP_003630.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 250-390 of human IKKγ (NP_003630.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IKKγ

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPE

• Gene ID:
• 8517

• Uniprot-ID:
• Q9Y6K9

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, Mouse brain, Rat brain