Rabbit anti-Human IKB-α Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08322P

• Product Name:
• Rabbit anti-Human IKB-α Polyclonal Antibody

• Synonym:
• IKBA; MAD-3; NFKBI; EDAID2; IKB-α

• Description:
• The antibody against IKB-α was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IκBα (NP_065390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IκBα (NP_065390.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IKB-α

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGD

• Gene ID:
• 4792

• Uniprot-ID:
• P25963

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, HeLa, NIH/3T3, Rat thymus, PC-12