Rabbit anti-Human Ikaros Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04482P

• Product Name:
• Rabbit anti-Human Ikaros Polyclonal Antibody

• Synonym:
• IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452; Ikaros

• Description:
• The antibody against Ikaros was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-270 of human Ikaros (NP_001207694.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-270 of human Ikaros (NP_001207694.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Ikaros

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMD

• Gene ID:
• 10320

• Uniprot-ID:
• Q13422

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji