Rabbit anti-Human IFNL3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08683P

• Product Name:
• Rabbit anti-Human IFNL3 Polyclonal Antibody

• Synonym:
• IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4; IFNL3

• Description:
• The antibody against IFNL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-196 of human IFNL3 (NP_742151.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-196 of human IFNL3 (NP_742151.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IFNL3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

• Gene ID:
• 282617

• Uniprot-ID:
• Q8IZI9

• Purification Method:
• Affinity purification