Rabbit anti-Human IFNL2/IFNL3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03726P

• Product Name:
• Rabbit anti-Human IFNL2/IFNL3 Polyclonal Antibody

• Synonym:
• IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4; IFNL2/IFNL3

• Description:
• The antibody against IFNL2/IFNL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFNL2/IFNL3 (NP_742151.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFNL2/IFNL3 (NP_742151.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IFNL2/IFNL3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELAL

• Gene ID:
• 282617

• Uniprot-ID:
• Q8IZI9

• Purification Method:
• Affinity purification

• Positive Samples:
• Recombinant Human IFNL3 Protein, K-562, Mouse thymus