Rabbit anti-Human IFIT2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10277P

• Product Name:
• Rabbit anti-Human IFIT2 Polyclonal Antibody

• Synonym:
• P54; G10P2; IFI54; ISG54; cig42; IFI-54; IFIT-2; ISG-54; GARG-39; IFI-54K; ISG-54K; ISG-54 K; IFIT2

• Description:
• The antibody against IFIT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 273-472 of human IFIT2 (NP_001538.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 273-472 of human IFIT2 (NP_001538.4).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IFIT2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGE

• Gene ID:
• 3433

• Uniprot-ID:
• P09913

• Purification Method:
• Affinity purification

• Positive Samples:
• A-431, HepG2