Rabbit anti-Human IFI27 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11436P

• Product Name:
• Rabbit anti-Human IFI27 Polyclonal Antibody

• Synonym:
• P27; ISG12; FAM14D; ISG12A; IFI27

• Description:
• The antibody against IFI27 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFI27 (NP_005523.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFI27 (NP_005523.3).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IFI27

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLT

• Gene ID:
• 3429

• Uniprot-ID:
• P40305

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat heart