Rabbit anti-Human IκB-ζ Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08492P

• Product Name:
• Rabbit anti-Human IκB-ζ Polyclonal Antibody

• Synonym:
• IKBZ; INAP; MAIL; ikB-zeta; ikappaBzeta; IkappaB-zeta; I-kappa-B-zeta; NFKBIZ

• Description:
• The antibody against IκB-ζ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IκB-ζ(NP_113607.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IκB-ζ(NP_113607.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IκB-ζ

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAPGSPGSDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPH

• Gene ID:
• 64332

• Uniprot-ID:
• Q9BYH8

• Purification Method:
• Affinity purification