Rabbit anti-Human Human Neurogranin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07953P

• Product Name:
• Rabbit anti-Human Human Neurogranin Polyclonal Antibody

• Synonym:
• RC3; hng; Human Neurogranin

• Description:
• The antibody against Human Neurogranin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-78 of human Human Neurogranin (NP_001119653.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 2-78 of human Human Neurogranin (NP_001119653.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Human Neurogranin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

• Gene ID:
• 4900

• Uniprot-ID:
• Q92686

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Rat brain