Rabbit anti-Human Human CD45RA Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08345P

• Product Name:
• Rabbit anti-Human Human CD45RA Polyclonal Antibody

• Synonym:
• PTPRC; B220; CD45; CD45R; GP180; L-CA; LCA; LY5; T200; receptor-type tyrosine-protein phosphatase C; Human CD45RA

• Description:
• The antibody against Human CD45RA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 10-110 of human CD45RA(P08575-8) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 10-110 of human CD45RA(P08575-8).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Human CD45RA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTDAYLNASETTT

• Gene ID:
• 5788

• Uniprot-ID:
• P08575

• Purification Method:
• Affinity purification