Rabbit anti-Human Human CD3E Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08184P

• Product Name:
• Rabbit anti-Human Human CD3E Polyclonal Antibody

• Synonym:
• CD3E; IMD18; T3E; TCRE; CD3e molecule; Human CD3E

• Description:
• The antibody against Human CD3E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-126 of human CD3E(NP_000724.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-126 of human CD3E(NP_000724.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Human CD3E

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

• Gene ID:
• 916

• Uniprot-ID:
• P07766

• Purification Method:
• Affinity purification

• Positive Samples:
• MOLT-4, Jurkat, Jurkat