Rabbit anti-Human HTR1F Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05476P

• Product Name:
• Rabbit anti-Human HTR1F Polyclonal Antibody

• Synonym:
• 5HT6; MR77; 5-HT1F; HTR1EL; 5-HT-1F; HTR1F

• Description:
• The antibody against HTR1F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HTR1F

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERK

• Gene ID:
• 3355

• Uniprot-ID:
• P30939

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, Mouse brain, Rat brain